SCOPe 2.08: Domain d5tsfa1: 5tsf A:1-208

Lineage for d5tsfa1 (5tsf A:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5tsfa1: 5tsf A:1-208 [340638]
   Other proteins in same PDB: d5tsfa2, d5tsfb2, d5tsfc2, d5tsfd2, d5tsfe2
   automated match to d2w8gc_
   complexed with 7ko, nag

Details for d5tsfa1

PDB Entry: 5tsf, 2.29 Å

PDB Description: crystal structure of achbp from aplysia californica complex with 2- aminopyrimidine at ph 7.0 spacegroup p212121

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5tsfa1:

Sequence; same for both SEQRES and ATOM records:

>d5tsfa1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d5tsfa1:

• d5tsfa1 first appeared in SCOPe 2.06
  
• d5tsfa1 appears in SCOPe 2.07