Lineage for d5tsfd1 (5tsf D:1-208)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2280724Species Aplysia californica [TaxId:6500] [324025] (3 PDB entries)
  8. 2297447Domain d5tsfd1: 5tsf D:1-208 [340748]
    Other proteins in same PDB: d5tsfa2, d5tsfb2, d5tsfc2, d5tsfd2, d5tsfe2
    automated match to d2w8gc_
    complexed with 7ko, nag

Details for d5tsfd1

PDB Entry: 5tsf (more details), 2.29 Å

PDB Description: crystal structure of achbp from aplysia californica complex with 2- aminopyrimidine at ph 7.0 spacegroup p212121
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5tsfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tsfd1 b.96.1.0 (D:1-208) automated matches {Aplysia californica [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d5tsfd1:

Click to download the PDB-style file with coordinates for d5tsfd1.
(The format of our PDB-style files is described here.)

Timeline for d5tsfd1:

  • d5tsfd1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29