PDB entry 5tsf

View 5tsf on RCSB PDB site
Description: Crystal structure of AChBP from Aplysia californica complex with 2-aminopyrimidine at pH 7.0 spacegroup P212121
Class: metal binding protein
Keywords: AChBP, 2-aminopyrimidi9ne complex, METAL BINDING PROTEIN
Deposited on 2016-10-28, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (6-8)
    Domains in SCOPe 2.07: d5tsfa1, d5tsfa2
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (4-8)
    Domains in SCOPe 2.07: d5tsfb1, d5tsfb2
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (6-8)
    Domains in SCOPe 2.07: d5tsfc1, d5tsfc2
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (6-8)
    Domains in SCOPe 2.07: d5tsfd1, d5tsfd2
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (0-8)
    Domains in SCOPe 2.07: d5tsfe1, d5tsfe2
  • Heterogens: 7KO, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tsfA (A:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsfA (A:)
    dklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeq
    qrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmf
    ipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeil
    satqtrqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tsfB (B:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsfB (B:)
    dddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyy
    eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
    mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
    ilsatqtrqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tsfC (C:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsfC (C:)
    dklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeq
    qrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmf
    ipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeil
    satqtrqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tsfD (D:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsfD (D:)
    dklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeq
    qrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmf
    ipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeil
    satqtrqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tsfE (E:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsfE (E:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerr