SCOPe 2.06: Domain d1eo1a_: 1eo1 A:

Lineage for d1eo1a_ (1eo1 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families)

5. Family c.55.5.1: MTH1175-like [53147] (3 proteins)

6. Protein Hypothetical protein MTH1175 [53148] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [53149] (1 PDB entry)

8. Domain d1eo1a_: 1eo1 A: [33739]
   structural genomics

Details for d1eo1a_

PDB Entry: 1eo1

PDB Description: solution structure of hypothetical protein mth1175 from methanobacterium thermoautotrophicum

PDB Compounds: (A:) hypothetical protein mth1175

SCOPe Domain Sequences for d1eo1a_:

Sequence; same for both SEQRES and ATOM records:

>d1eo1a_ c.55.5.1 (A:) Hypothetical protein MTH1175 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqi
ianngvkaviasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrg
rrrr

Timeline for d1eo1a_:

• d1eo1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eo1a_ appears in SCOPe 2.05
  
• d1eo1a_ appears in SCOPe 2.07
  
• d1eo1a_ appears in the current release, SCOPe 2.08