Lineage for d1eo1a_ (1eo1 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25449Superfamily c.55.5: Hypothetical protein MTH1175 [53146] (1 family) (S)
  5. 25450Family c.55.5.1: Hypothetical protein MTH1175 [53147] (1 protein)
  6. 25451Protein Hypothetical protein MTH1175 [53148] (1 species)
  7. 25452Species Archaea (Methanobacterium thermoautotrophicum) [TaxId:145262] [53149] (1 PDB entry)
  8. 25453Domain d1eo1a_: 1eo1 A: [33739]

Details for d1eo1a_

PDB Entry: 1eo1 (more details)

PDB Description: solution structure of hypothetical protein mth1175 from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1eo1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo1a_ c.55.5.1 (A:) Hypothetical protein MTH1175 {Archaea (Methanobacterium thermoautotrophicum)}
mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqi
ianngvkaviasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrg
rrrr

SCOP Domain Coordinates for d1eo1a_:

Click to download the PDB-style file with coordinates for d1eo1a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo1a_: