Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.5: Hypothetical protein MTH1175 [53146] (1 family) |
Family c.55.5.1: Hypothetical protein MTH1175 [53147] (1 protein) |
Protein Hypothetical protein MTH1175 [53148] (1 species) |
Species Archaea (Methanobacterium thermoautotrophicum) [TaxId:145262] [53149] (1 PDB entry) |
Domain d1eo1a_: 1eo1 A: [33739] |
PDB Entry: 1eo1 (more details)
SCOP Domain Sequences for d1eo1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo1a_ c.55.5.1 (A:) Hypothetical protein MTH1175 {Archaea (Methanobacterium thermoautotrophicum)} mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqi ianngvkaviasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrg rrrr
Timeline for d1eo1a_: