Lineage for d1eo1a_ (1eo1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495539Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 2495540Family c.55.5.1: MTH1175-like [53147] (3 proteins)
  6. 2495541Protein Hypothetical protein MTH1175 [53148] (1 species)
  7. 2495542Species Methanobacterium thermoautotrophicum [TaxId:145262] [53149] (1 PDB entry)
  8. 2495543Domain d1eo1a_: 1eo1 A: [33739]
    structural genomics

Details for d1eo1a_

PDB Entry: 1eo1 (more details)

PDB Description: solution structure of hypothetical protein mth1175 from methanobacterium thermoautotrophicum
PDB Compounds: (A:) hypothetical protein mth1175

SCOPe Domain Sequences for d1eo1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo1a_ c.55.5.1 (A:) Hypothetical protein MTH1175 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqi
ianngvkaviasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrg
rrrr

SCOPe Domain Coordinates for d1eo1a_:

Click to download the PDB-style file with coordinates for d1eo1a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo1a_: