PDB entry 1eo1

View 1eo1 on RCSB PDB site
Description: Solution structure of hypothetical protein MTH1175 from Methanobacterium thermoautotrophicum
Class: structural genomics
Keywords: mixed a/b protein, mixed beta sheet, strand order 321456,strands 2 and 6 antiparallel to rest., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2000-03-21, released 2000-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein mth1175
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eo1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo1A (A:)
    mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqi
    ianngvkaviasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrg
    rrrr