Lineage for d5vxtb1 (5vxt B:1-316)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035756Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2036175Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2036176Protein automated matches [227026] (4 species)
    not a true protein
  7. 2292191Species Burkholderia ambifaria [TaxId:398577] [335492] (1 PDB entry)
  8. 2292198Domain d5vxtb1: 5vxt B:1-316 [335499]
    Other proteins in same PDB: d5vxta2, d5vxtb2
    automated match to d1dmha_
    complexed with caq, cl, edo, fe, pty

Details for d5vxtb1

PDB Entry: 5vxt (more details), 1.75 Å

PDB Description: crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
PDB Compounds: (B:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d5vxtb1:

Sequence, based on SEQRES records: (download)

>d5vxtb1 b.3.6.0 (B:1-316) automated matches {Burkholderia ambifaria [TaxId: 398577]}
msvkvfdtkevqdllkaasnagtngangtqagnartqqivhrllgdlfkaiddlditpde
vwagvnylnklgqdgeaallaaglglekyldirmdaedeaigldggtprtiegplyvaga
pvrdgvakidldadegagplvihgtvtgldgkpvagalvecwhanshgfyshfdptgkqs
dfnlrgavktgadgkyefrtlmpvgygcppqgatqqlldrlgrhgnrpahvhffvtsdgh
rklttqfniegdpliwddfayatreelippvtakaggaalglkadayqdiefnfvltprv
egkdnqiverlrasat

Sequence, based on observed residues (ATOM records): (download)

>d5vxtb1 b.3.6.0 (B:1-316) automated matches {Burkholderia ambifaria [TaxId: 398577]}
msvkvfdtkevqdllkaasnagagnartqqivhrllgdlfkaiddlditpdevwagvnyl
nklgqdgeaallaaglglekyldirmdaedeaigldggtprtiegplyvagapvrdgvak
idldadegagplvihgtvtgldgkpvagalvecwhanshgfyshfdptgkqsdfnlrgav
ktgadgkyefrtlmpvgygcppqgatqqlldrlgrhgnrpahvhffvtsdghrklttqfn
iegdpliwddfayatreelippvtakaggaalglkadayqdiefnfvltprvegkdnqiv
erlrasat

SCOPe Domain Coordinates for d5vxtb1:

Click to download the PDB-style file with coordinates for d5vxtb1.
(The format of our PDB-style files is described here.)

Timeline for d5vxtb1:

  • d5vxtb1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5vxtb2