SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vxta1 (5vxt A:1-315)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035756Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2036175Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2036176Protein automated matches [227026] (4 species)
    not a true protein
  7. 2292191Species Burkholderia ambifaria [TaxId:398577] [335492] (1 PDB entry)
  8. 2292192Domain d5vxta1: 5vxt A:1-315 [335493]
    Other proteins in same PDB: d5vxta2, d5vxtb2
    automated match to d1dmha_
    complexed with caq, cl, edo, fe, pty

Details for d5vxta1

PDB Entry: 5vxt (more details), 1.75 Å

PDB Description: crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d5vxta1:

Sequence, based on SEQRES records: (download)

>d5vxta1 b.3.6.0 (A:1-315) automated matches {Burkholderia ambifaria [TaxId: 398577]}
msvkvfdtkevqdllkaasnagtngangtqagnartqqivhrllgdlfkaiddlditpde
vwagvnylnklgqdgeaallaaglglekyldirmdaedeaigldggtprtiegplyvaga
pvrdgvakidldadegagplvihgtvtgldgkpvagalvecwhanshgfyshfdptgkqs
dfnlrgavktgadgkyefrtlmpvgygcppqgatqqlldrlgrhgnrpahvhffvtsdgh
rklttqfniegdpliwddfayatreelippvtakaggaalglkadayqdiefnfvltprv
egkdnqiverlrasa

Sequence, based on observed residues (ATOM records): (download)

>d5vxta1 b.3.6.0 (A:1-315) automated matches {Burkholderia ambifaria [TaxId: 398577]}
msvkvfdtkevqdllkaasnagagnartqqivhrllgdlfkaiddlditpdevwagvnyl
nklgqdgeaallaaglglekyldirmdaedeaigldggtprtiegplyvagapvrdgvak
idldadegagplvihgtvtgldgkpvagalvecwhanshgfyshfdptgkqsdfnlrgav
ktgadgkyefrtlmpvgygcppqgatqqlldrlgrhgnrpahvhffvtsdghrklttqfn
iegdpliwddfayatreelippvtakaggaalglkadayqdiefnfvltprvegkdnqiv
erlrasa

SCOPe Domain Coordinates for d5vxta1:

Click to download the PDB-style file with coordinates for d5vxta1.
(The format of our PDB-style files is described here.)

Timeline for d5vxta1:

  • d5vxta1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5vxta2