Lineage for d5jvlc1 (5jvl C:1-380)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (32 species)
    not a true protein
  7. 2289251Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)
  8. 2289395Domain d5jvlc1: 5jvl C:1-380 [332696]
    Other proteins in same PDB: d5jvla2, d5jvla3, d5jvlb1, d5jvlc2, d5jvlc3, d5jvld2, d5jvld3
    automated match to d1vbga3
    complexed with 6nq, mg, pep

Details for d5jvlc1

PDB Entry: 5jvl (more details), 2.9 Å

PDB Description: c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue
PDB Compounds: (C:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvlc1:

Sequence, based on SEQRES records: (download)

>d5jvlc1 d.142.1.0 (C:1-380) automated matches {Flaveria trinervia [TaxId: 4227]}
kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl
ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd
lvekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qsmvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmp
eaykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllhp

Sequence, based on observed residues (ATOM records): (download)

>d5jvlc1 d.142.1.0 (C:1-380) automated matches {Flaveria trinervia [TaxId: 4227]}
kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl
ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd
lvekyknvyveakgekfptdpkkqlelavnavfdswdlkgtavniqsmvfgnmgntsgtg
vlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpeaykelvenceiler
hykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglidtrtaikrvetqhld
qllhp

SCOPe Domain Coordinates for d5jvlc1:

Click to download the PDB-style file with coordinates for d5jvlc1.
(The format of our PDB-style files is described here.)

Timeline for d5jvlc1:

  • d5jvlc1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06