SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvld1 (5jvl D:1-380)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (32 species)
    not a true protein
  7. 2289251Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)
  8. 2289294Domain d5jvld1: 5jvl D:1-380 [332595]
    Other proteins in same PDB: d5jvla2, d5jvla3, d5jvlb1, d5jvlc2, d5jvlc3, d5jvld2, d5jvld3
    automated match to d1vbga3
    complexed with 6nq, mg, pep

Details for d5jvld1

PDB Entry: 5jvl (more details), 2.9 Å

PDB Description: c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue
PDB Compounds: (D:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvld1 d.142.1.0 (D:1-380) automated matches {Flaveria trinervia [TaxId: 4227]}
kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl
ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd
lvekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qsmvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmp
eaykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllhp

SCOPe Domain Coordinates for d5jvld1:

Click to download the PDB-style file with coordinates for d5jvld1.
(The format of our PDB-style files is described here.)

Timeline for d5jvld1:

  • d5jvld1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06