Lineage for d5jvld2 (5jvl D:381-515)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2097884Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2097916Family c.8.1.0: automated matches [310665] (1 protein)
    not a true family
  6. 2097917Protein automated matches [310840] (3 species)
    not a true protein
  7. 2289253Species Flaveria trinervia [TaxId:4227] [332554] (3 PDB entries)
  8. 2289295Domain d5jvld2: 5jvl D:381-515 [332596]
    Other proteins in same PDB: d5jvla1, d5jvla3, d5jvlb1, d5jvlc1, d5jvlc3, d5jvld1, d5jvld3
    automated match to d1vbga2
    complexed with 6nq, mg, pep

Details for d5jvld2

PDB Entry: 5jvl (more details), 2.9 Å

PDB Description: c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue
PDB Compounds: (D:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvld2 c.8.1.0 (D:381-515) automated matches {Flaveria trinervia [TaxId: 4227]}
qfedpsaykshvvatglpaspgaavgqvcfsaedaetwhaqgksailvrtetspedvggm
haaagiltarggmtshaavvargwgkccvsgcadirvnddmkiftigdrvikegdwlsln
gttgevilgkqllap

SCOPe Domain Coordinates for d5jvld2:

Click to download the PDB-style file with coordinates for d5jvld2.
(The format of our PDB-style files is described here.)

Timeline for d5jvld2:

  • d5jvld2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06