Lineage for d5jvna1 (5jvn A:1-379)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (32 species)
    not a true protein
  7. 2289327Species Flaveria pringlei [TaxId:4226] [332628] (1 PDB entry)
  8. 2289328Domain d5jvna1: 5jvn A:1-379 [332629]
    Other proteins in same PDB: d5jvna2, d5jvna3, d5jvna4
    automated match to d2x0sa3
    complexed with 6nq, mg, pep

Details for d5jvna1

PDB Entry: 5jvn (more details), 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvna1 d.142.1.0 (A:1-379) automated matches {Flaveria pringlei [TaxId: 4226]}
kkrvftfgkgrsegnkdmksllggkganlaemasiglsvppgltisteaceeyqqngkkl
ppglwdeileglryvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleemkaekgvhldtdltaadlkd
lveqyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qcmvfgnmgntsgtgvlftrnpstgekklygeflvnaqgedvvagirtpedlatmetcmp
eayrelvenckilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllh

SCOPe Domain Coordinates for d5jvna1:

Click to download the PDB-style file with coordinates for d5jvna1.
(The format of our PDB-style files is described here.)

Timeline for d5jvna1:

  • d5jvna1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05