SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvna1 (5jvn A:1-379)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (31 species)
    not a true protein
  7. 2289327Species Flaveria pringlei [TaxId:4226] [332628] (1 PDB entry)
  8. 2289328Domain d5jvna1: 5jvn A:1-379 [332629]
    Other proteins in same PDB: d5jvna2, d5jvna3, d5jvna4
    automated match to d2x0sa3
    complexed with 6nq, mg, pep

Details for d5jvna1

PDB Entry: 5jvn (more details), 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvna1 d.142.1.0 (A:1-379) automated matches {Flaveria pringlei [TaxId: 4226]}
kkrvftfgkgrsegnkdmksllggkganlaemasiglsvppgltisteaceeyqqngkkl
ppglwdeileglryvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleemkaekgvhldtdltaadlkd
lveqyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qcmvfgnmgntsgtgvlftrnpstgekklygeflvnaqgedvvagirtpedlatmetcmp
eayrelvenckilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllh

SCOPe Domain Coordinates for d5jvna1:

Click to download the PDB-style file with coordinates for d5jvna1.
(The format of our PDB-style files is described here.)

Timeline for d5jvna1:

  • d5jvna1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05