Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Flaveria pringlei [TaxId:4226] [332628] (1 PDB entry) |
Domain d5jvna1: 5jvn A:1-379 [332629] Other proteins in same PDB: d5jvna2, d5jvna3, d5jvna4 automated match to d2x0sa3 complexed with 6nq, mg, pep |
PDB Entry: 5jvn (more details), 2.9 Å
SCOPe Domain Sequences for d5jvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jvna1 d.142.1.0 (A:1-379) automated matches {Flaveria pringlei [TaxId: 4226]} kkrvftfgkgrsegnkdmksllggkganlaemasiglsvppgltisteaceeyqqngkkl ppglwdeileglryvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva glagksgarfaydsyrrfldmfgnvvmgiphslfdekleemkaekgvhldtdltaadlkd lveqyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni qcmvfgnmgntsgtgvlftrnpstgekklygeflvnaqgedvvagirtpedlatmetcmp eayrelvenckilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli dtrtaikrvetqhldqllh
Timeline for d5jvna1: