SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvna2 (5jvn A:380-513)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2097884Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2097916Family c.8.1.0: automated matches [310665] (1 protein)
    not a true family
  6. 2097917Protein automated matches [310840] (3 species)
    not a true protein
  7. 2289329Species Flaveria pringlei [TaxId:4226] [332630] (1 PDB entry)
  8. 2289330Domain d5jvna2: 5jvn A:380-513 [332631]
    Other proteins in same PDB: d5jvna1, d5jvna3, d5jvna4
    automated match to d2x0sa2
    complexed with 6nq, mg, pep

Details for d5jvna2

PDB Entry: 5jvn (more details), 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna2:

Sequence, based on SEQRES records: (download)

>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]}
pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg
mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltigdrvikegdwlsl
ngstgevilgkqll

Sequence, based on observed residues (ATOM records): (download)

>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]}
pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg
mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltirvikegdwlslng
stgevilgkqll

SCOPe Domain Coordinates for d5jvna2:

Click to download the PDB-style file with coordinates for d5jvna2.
(The format of our PDB-style files is described here.)

Timeline for d5jvna2:

  • d5jvna2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06