SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvna3 (5jvn A:514-874)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2289331Species Flaveria pringlei [TaxId:4226] [332632] (1 PDB entry)
  8. 2289332Domain d5jvna3: 5jvn A:514-874 [332633]
    Other proteins in same PDB: d5jvna1, d5jvna2, d5jvna4
    automated match to d2x0sa1
    complexed with 6nq, mg, pep

Details for d5jvna3

PDB Entry: 5jvn (more details), 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvna3 c.1.12.0 (A:514-874) automated matches {Flaveria pringlei [TaxId: 4226]}
appamsndletfmswadqvrrlkvmanadtpndaltarnngaqgiglcrtehmffasder
ikavrkmimavtpeqrkaaldlllpyqrsdfegiframdglpvtirlldpplheflpegd
lehivnelavdtgmsedeiyskieklsevnpmlgfrgcrlgisypeltemqvraifqaav
smnnqgvtvipeimvplvgtpqelrhqigvirgvaanvfaemgltmdykvgtmieipraa
liaeeiakeaeffsfgtndltqmtfgysrddvgkflqiylsqgilqhdpfevldqkgvgq
likmatekgraanpnlkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqvv
v

SCOPe Domain Coordinates for d5jvna3:

Click to download the PDB-style file with coordinates for d5jvna3.
(The format of our PDB-style files is described here.)

Timeline for d5jvna3:

  • d5jvna3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06