SCOPe 2.08: Domain d5f0ga2: 5f0g A:85-212

Lineage for d5f0ga2 (5f0g A:85-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)

8. Domain d5f0ga2: 5f0g A:85-212 [332533]
   Other proteins in same PDB: d5f0ga1, d5f0gb1
   automated match to d3vk9c2
   complexed with k, na

Details for d5f0ga2

PDB Entry: 5f0g, 1.6 Å

PDB Description: structure of the glutathione transferase delta 2 from drosophila melanogaster

PDB Compounds: (A:) Glutathione S-transferase D2

SCOPe Domain Sequences for d5f0ga2:

Sequence, based on SEQRES records:

>d5f0ga2 a.45.1.0 (A:85-212) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndpkkravinqrlyfdmgtlyesfakyyyplfrtgkpgsdedlkrietafgfldtflegq
eyvagdqltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamk
alfdarkl

Sequence, based on observed residues (ATOM records):

>d5f0ga2 a.45.1.0 (A:85-212) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndpkkravinqrlyfdmgtlyesfakyyyplpgsdedlkrietafgfldtflegqeyvag
dqltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamkalfda
rkl

Timeline for d5f0ga2:

• d5f0ga2 first appeared in SCOPe 2.06
  
• d5f0ga2 appears in SCOPe 2.07