Lineage for d5f0ga1 (5f0g A:1-84)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2119407Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (8 PDB entries)
  8. 2289230Domain d5f0ga1: 5f0g A:1-84 [332529]
    Other proteins in same PDB: d5f0ga2, d5f0gb2
    automated match to d3vk9a1
    complexed with k, na

Details for d5f0ga1

PDB Entry: 5f0g (more details), 1.6 Å

PDB Description: structure of the glutathion transferase delta 2 from drosophila melanogaster
PDB Compounds: (A:) Glutathione S-transferase D2

SCOPe Domain Sequences for d5f0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0ga1 c.47.1.0 (A:1-84) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdfyympggggcrtvimvakalglelnkkllntmegeqlkpefvklnpqhtiptlvdngf
siwesraiavylvekygkddyllp

SCOPe Domain Coordinates for d5f0ga1:

Click to download the PDB-style file with coordinates for d5f0ga1.
(The format of our PDB-style files is described here.)

Timeline for d5f0ga1:

  • d5f0ga1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5f0ga2