SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f0gb2 (5f0g B:85-208)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 1997552Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (8 PDB entries)
  8. 2289233Domain d5f0gb2: 5f0g B:85-208 [332534]
    Other proteins in same PDB: d5f0ga1, d5f0gb1
    automated match to d3vk9c2
    complexed with k, na

Details for d5f0gb2

PDB Entry: 5f0g (more details), 1.6 Å

PDB Description: structure of the glutathion transferase delta 2 from drosophila melanogaster
PDB Compounds: (B:) Glutathione S-transferase D2

SCOPe Domain Sequences for d5f0gb2:

Sequence, based on SEQRES records: (download)

>d5f0gb2 a.45.1.0 (B:85-208) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndpkkravinqrlyfdmgtlyesfakyyyplfrtgkpgsdedlkrietafgfldtflegq
eyvagdqltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamk
alfd

Sequence, based on observed residues (ATOM records): (download)

>d5f0gb2 a.45.1.0 (B:85-208) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndpkkravinqrlyfdmgtlyesfakyyyplgsdedlkrietafgfldtflegqeyvagd
qltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamkalfd

SCOPe Domain Coordinates for d5f0gb2:

Click to download the PDB-style file with coordinates for d5f0gb2.
(The format of our PDB-style files is described here.)

Timeline for d5f0gb2:

  • d5f0gb2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5f0gb1