SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f0gb1 (5f0g B:1-84)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (163 species)
    not a true protein
  7. 2119407Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (8 PDB entries)
  8. 2289229Domain d5f0gb1: 5f0g B:1-84 [332530]
    Other proteins in same PDB: d5f0ga2, d5f0gb2
    automated match to d3vk9a1
    complexed with k, na

Details for d5f0gb1

PDB Entry: 5f0g (more details), 1.6 Å

PDB Description: structure of the glutathion transferase delta 2 from drosophila melanogaster
PDB Compounds: (B:) Glutathione S-transferase D2

SCOPe Domain Sequences for d5f0gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0gb1 c.47.1.0 (B:1-84) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdfyympggggcrtvimvakalglelnkkllntmegeqlkpefvklnpqhtiptlvdngf
siwesraiavylvekygkddyllp

SCOPe Domain Coordinates for d5f0gb1:

Click to download the PDB-style file with coordinates for d5f0gb1.
(The format of our PDB-style files is described here.)

Timeline for d5f0gb1:

  • d5f0gb1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5f0gb2