Lineage for d5jraa1 (5jra A:2-126)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987599Protein automated matches [190363] (5 species)
    not a true protein
  7. 2287374Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (7 PDB entries)
  8. 2287423Domain d5jraa1: 5jra A:2-126 [330724]
    Other proteins in same PDB: d5jraa2
    automated match to d4cdaa_
    complexed with asc, hec, no, so4; mutant

Details for d5jraa1

PDB Entry: 5jra (more details), 1.38 Å

PDB Description: nitric oxide complex of the l16v mutant of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jraa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jraa1 a.24.3.2 (A:2-126) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
fakpedavkyrqsavtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafgp
gteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckachd
ayrkk

SCOPe Domain Coordinates for d5jraa1:

Click to download the PDB-style file with coordinates for d5jraa1.
(The format of our PDB-style files is described here.)

Timeline for d5jraa1:

  • d5jraa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5jraa2