Lineage for d5uu6a1 (5uu6 A:1-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963565Species Vibrio parahaemolyticus [TaxId:223926] [330502] (1 PDB entry)
  8. 2963566Domain d5uu6a1: 5uu6 A:1-240 [330520]
    Other proteins in same PDB: d5uu6a2, d5uu6c2, d5uu6d2
    automated match to d1f5va_
    complexed with cl, fmn, gol

Details for d5uu6a1

PDB Entry: 5uu6 (more details), 1.95 Å

PDB Description: the crystal structure of nitroreductase a from vibrio parahaemolyticus rimd 2210633
PDB Compounds: (A:) nadph-flavin oxidoreductase

SCOPe Domain Sequences for d5uu6a1:

Sequence, based on SEQRES records: (download)

>d5uu6a1 d.90.1.0 (A:1-240) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}
mnstiqtilghrsirkftsqpidkeqletilqaglaassssmlqvvsivrvtdiekrsql
akfagnqayvesaaeflvfcidyqrhasinpdvqadftelmligavdsgimaqncllaae
smglggvyigglrnnaqqvdellglpqntailfgmclghpdqnpevkprlpahvvvhenq
yqdlnlddiqaydqtmqnyyanrssnqkqstwsqevtsklagesrphilpylngkglakk

Sequence, based on observed residues (ATOM records): (download)

>d5uu6a1 d.90.1.0 (A:1-240) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}
mnstiqtilghrsirkftsqpidkeqletilqaglaassssmlqvvsivrvtdiekrsql
akfagnqayvesaaeflvfcidyqrhasinpdvqadftelmligavdsgimaqncllaae
smglggvyigglrnnaqqvdellglpqntailfgmclghpdqnpevkprlpahvvvhenq
yqdlnlddiqaydqtmqnyyastwsqevtsklagesrphilpylngkglakk

SCOPe Domain Coordinates for d5uu6a1:

Click to download the PDB-style file with coordinates for d5uu6a1.
(The format of our PDB-style files is described here.)

Timeline for d5uu6a1: