SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uu6b_ (5uu6 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183409Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2183410Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2183540Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2183541Protein automated matches [190672] (25 species)
    not a true protein
  7. 2287201Species Vibrio parahaemolyticus [TaxId:223926] [330502] (1 PDB entry)
  8. 2287202Domain d5uu6b_: 5uu6 B: [330503]
    Other proteins in same PDB: d5uu6a2, d5uu6c2, d5uu6d2
    automated match to d1f5va_
    complexed with cl, fmn, gol

Details for d5uu6b_

PDB Entry: 5uu6 (more details), 1.95 Å

PDB Description: the crystal structure of nitroreductase a from vibrio parahaemolyticus rimd 2210633
PDB Compounds: (B:) nadph-flavin oxidoreductase

SCOPe Domain Sequences for d5uu6b_:

Sequence, based on SEQRES records: (download)

>d5uu6b_ d.90.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}
mnstiqtilghrsirkftsqpidkeqletilqaglaassssmlqvvsivrvtdiekrsql
akfagnqayvesaaeflvfcidyqrhasinpdvqadftelmligavdsgimaqncllaae
smglggvyigglrnnaqqvdellglpqntailfgmclghpdqnpevkprlpahvvvhenq
yqdlnlddiqaydqtmqnyyanrssnqkqstwsqevtsklagesrphilpylngkglakk

Sequence, based on observed residues (ATOM records): (download)

>d5uu6b_ d.90.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}
mnstiqtilghrsirkftsqpidkeqletilqaglaassssmlqvvsivrvtdiekrsql
akfagnqayvesaaeflvfcidyqrhasinpdvqadftelmligavdsgimaqncllaae
smglggvyigglrnnaqqvdellglpqntailfgmclghpdqnpevkprlpahvvvhenq
yqdlnlddiqaydqtmqnyyaqstwsqevtsklagesrphilpylngkglakk

SCOPe Domain Coordinates for d5uu6b_:

Click to download the PDB-style file with coordinates for d5uu6b_.
(The format of our PDB-style files is described here.)

Timeline for d5uu6b_:

  • d5uu6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02