Lineage for d5gxub1 (5gxu B:304-553)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054836Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2054837Protein automated matches [226870] (20 species)
    not a true protein
  7. 2285523Species Arabidopsis thaliana [TaxId:3702] [328824] (1 PDB entry)
  8. 2285524Domain d5gxub1: 5gxu B:304-553 [328825]
    Other proteins in same PDB: d5gxub2
    automated match to d3fjoa2
    complexed with fad, fmn

Details for d5gxub1

PDB Entry: 5gxu (more details), 2.3 Å

PDB Description: cystal structure of arabidopsis atr2
PDB Compounds: (B:) NADPH--cytochrome P450 reductase 2

SCOPe Domain Sequences for d5gxub1:

Sequence, based on SEQRES records: (download)

>d5gxub1 b.43.4.0 (B:304-553) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ytvfdaqhpykanvavkrelhtpesdrscihlefdiagsgltyetgdhvgvlcdnlsetv
dealrlldmspdtyfslhaekedgtpissslpppfppcnlrtaltryacllsspkksalv
alaahasdpteaerlkhlaspagkdeyskwvvesqrsllevmaefpsakpplgvffagva
prlqprfysissspkiaetrihvtcalvyekmptgrihkgvcstwmknavpyeksencss
apifvrqsnf

Sequence, based on observed residues (ATOM records): (download)

>d5gxub1 b.43.4.0 (B:304-553) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ytvfdaqhpykanvavkrelhtpesdrscihlefdiagsgltyetgdhvgvlcdnlsetv
dealrlldmspdtyfslhppfppcnlrtaltryacllsspkksalvalaahasdpteaer
lkhlaspagkdeyskwvvesqrsllevmaefpsakpplgvffagvaprlqprfysisssp
kiaetrihvtcalvyekmptgrihkgvcstwmknavpyeksencssapifvrqsnf

SCOPe Domain Coordinates for d5gxub1:

Click to download the PDB-style file with coordinates for d5gxub1.
(The format of our PDB-style files is described here.)

Timeline for d5gxub1:

  • d5gxub1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25