Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [328824] (1 PDB entry) |
Domain d5gxub1: 5gxu B:304-553 [328825] Other proteins in same PDB: d5gxub2 automated match to d3fjoa2 complexed with fad, fmn |
PDB Entry: 5gxu (more details), 2.3 Å
SCOPe Domain Sequences for d5gxub1:
Sequence, based on SEQRES records: (download)
>d5gxub1 b.43.4.0 (B:304-553) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ytvfdaqhpykanvavkrelhtpesdrscihlefdiagsgltyetgdhvgvlcdnlsetv dealrlldmspdtyfslhaekedgtpissslpppfppcnlrtaltryacllsspkksalv alaahasdpteaerlkhlaspagkdeyskwvvesqrsllevmaefpsakpplgvffagva prlqprfysissspkiaetrihvtcalvyekmptgrihkgvcstwmknavpyeksencss apifvrqsnf
>d5gxub1 b.43.4.0 (B:304-553) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ytvfdaqhpykanvavkrelhtpesdrscihlefdiagsgltyetgdhvgvlcdnlsetv dealrlldmspdtyfslhppfppcnlrtaltryacllsspkksalvalaahasdpteaer lkhlaspagkdeyskwvvesqrsllevmaefpsakpplgvffagvaprlqprfysisssp kiaetrihvtcalvyekmptgrihkgvcstwmknavpyeksencssapifvrqsnf
Timeline for d5gxub1: