SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gxub1 (5gxu B:304-553)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054836Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2054837Protein automated matches [226870] (20 species)
    not a true protein
  7. 2285523Species Arabidopsis thaliana [TaxId:3702] [328824] (1 PDB entry)
  8. 2285524Domain d5gxub1: 5gxu B:304-553 [328825]
    Other proteins in same PDB: d5gxub2
    automated match to d3fjoa2
    complexed with fad, fmn

Details for d5gxub1

PDB Entry: 5gxu (more details), 2.3 Å

PDB Description: cystal structure of arabidopsis atr2
PDB Compounds: (B:) NADPH--cytochrome P450 reductase 2

SCOPe Domain Sequences for d5gxub1:

Sequence, based on SEQRES records: (download)

>d5gxub1 b.43.4.0 (B:304-553) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ytvfdaqhpykanvavkrelhtpesdrscihlefdiagsgltyetgdhvgvlcdnlsetv
dealrlldmspdtyfslhaekedgtpissslpppfppcnlrtaltryacllsspkksalv
alaahasdpteaerlkhlaspagkdeyskwvvesqrsllevmaefpsakpplgvffagva
prlqprfysissspkiaetrihvtcalvyekmptgrihkgvcstwmknavpyeksencss
apifvrqsnf

Sequence, based on observed residues (ATOM records): (download)

>d5gxub1 b.43.4.0 (B:304-553) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ytvfdaqhpykanvavkrelhtpesdrscihlefdiagsgltyetgdhvgvlcdnlsetv
dealrlldmspdtyfslhppfppcnlrtaltryacllsspkksalvalaahasdpteaer
lkhlaspagkdeyskwvvesqrsllevmaefpsakpplgvffagvaprlqprfysisssp
kiaetrihvtcalvyekmptgrihkgvcstwmknavpyeksencssapifvrqsnf

SCOPe Domain Coordinates for d5gxub1:

Click to download the PDB-style file with coordinates for d5gxub1.
(The format of our PDB-style files is described here.)

Timeline for d5gxub1:

  • d5gxub1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25