Lineage for d5gxub2 (5gxu B:554-711)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442174Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2442175Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2442345Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2442346Protein automated matches [226871] (17 species)
    not a true protein
  7. 2442463Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [328826] (1 PDB entry)
  8. 2442464Domain d5gxub2: 5gxu B:554-711 [328827]
    Other proteins in same PDB: d5gxub1
    automated match to d3fjoa3
    complexed with fad, fmn

Details for d5gxub2

PDB Entry: 5gxu (more details), 2.3 Å

PDB Description: cystal structure of arabidopsis atr2
PDB Compounds: (B:) NADPH--cytochrome P450 reductase 2

SCOPe Domain Sequences for d5gxub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxub2 c.25.1.0 (B:554-711) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
klpsdskvpiimigpgtglapfrgflqerlalvesgvelgpsvlffgcrnrrmdfiyeee
lqrfvesgalaelsvafsregptkeyvqhkmmdkasdiwnmisqgaylyvcgdakgmard
vhrslhtiaqeqgsmdstkaegfvknlqtsgrylrdvw

SCOPe Domain Coordinates for d5gxub2:

Click to download the PDB-style file with coordinates for d5gxub2.
(The format of our PDB-style files is described here.)

Timeline for d5gxub2: