SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gxub2 (5gxu B:554-711)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105290Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2105291Protein automated matches [226871] (18 species)
    not a true protein
  7. 2285525Species Arabidopsis thaliana [TaxId:3702] [328826] (1 PDB entry)
  8. 2285526Domain d5gxub2: 5gxu B:554-711 [328827]
    Other proteins in same PDB: d5gxub1
    automated match to d3fjoa3
    complexed with fad, fmn

Details for d5gxub2

PDB Entry: 5gxu (more details), 2.3 Å

PDB Description: cystal structure of arabidopsis atr2
PDB Compounds: (B:) NADPH--cytochrome P450 reductase 2

SCOPe Domain Sequences for d5gxub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxub2 c.25.1.0 (B:554-711) automated matches {Arabidopsis thaliana [TaxId: 3702]}
klpsdskvpiimigpgtglapfrgflqerlalvesgvelgpsvlffgcrnrrmdfiyeee
lqrfvesgalaelsvafsregptkeyvqhkmmdkasdiwnmisqgaylyvcgdakgmard
vhrslhtiaqeqgsmdstkaegfvknlqtsgrylrdvw

SCOPe Domain Coordinates for d5gxub2:

Click to download the PDB-style file with coordinates for d5gxub2.
(The format of our PDB-style files is described here.)

Timeline for d5gxub2:

  • d5gxub2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25