SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kanb_ (5kan B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (11 species)
    trimer
  7. 2238954Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (2 PDB entries)
  8. 2283534Domain d5kanb_: 5kan B: [326835]
    Other proteins in same PDB: d5kana_, d5kanc_, d5kane_, d5kani1, d5kani2, d5kank1, d5kank2, d5kanl1, d5kanl2
    automated match to d4d00d_
    complexed with nag

Details for d5kanb_

PDB Entry: 5kan (more details), 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5kanb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kanb_ h.3.1.1 (B:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv

SCOPe Domain Coordinates for d5kanb_:

Click to download the PDB-style file with coordinates for d5kanb_.
(The format of our PDB-style files is described here.)

Timeline for d5kanb_:

  • d5kanb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01