SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kani2 (5kan I:110-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (610 PDB entries)
  8. 2283530Domain d5kani2: 5kan I:110-214 [326831]
    Other proteins in same PDB: d5kana_, d5kanb_, d5kanc_, d5kand_, d5kane_, d5kanf_, d5kani1, d5kank1, d5kanl1
    automated match to d1gafl2
    complexed with nag

Details for d5kani2

PDB Entry: 5kan (more details), 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (I:) 16.g.07 Light chain

SCOPe Domain Sequences for d5kani2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kani2 b.1.1.2 (I:110-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOPe Domain Coordinates for d5kani2:

Click to download the PDB-style file with coordinates for d5kani2.
(The format of our PDB-style files is described here.)

Timeline for d5kani2:

  • d5kani2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-01