SCOPe 2.08: Domain d5kanl1: 5kan L:1-109

Lineage for d5kanl1 (5kan L:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5kanl1: 5kan L:1-109 [326686]
   Other proteins in same PDB: d5kana_, d5kanb_, d5kanc_, d5kand_, d5kane_, d5kanf_, d5kani2, d5kank2, d5kanl2
   automated match to d2rcsl1
   complexed with nag

Details for d5kanl1

PDB Entry: 5kan, 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin

PDB Compounds: (L:) 16.g.07 Light chain

SCOPe Domain Sequences for d5kanl1:

Sequence; same for both SEQRES and ATOM records:

>d5kanl1 b.1.1.0 (L:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqvpvslsafvgdrvsitcrasqdisrwlawyqqkpgrapklliyaasslqggvps
rfrgsgsgteftltisglqpedfatyycqqgstfpytsvlgtilgipgt

Timeline for d5kanl1:

• d5kanl1 first appeared in SCOPe 2.06
  
• d5kanl1 appears in SCOPe 2.07