Lineage for d5t5fl1 (5t5f L:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (566 PDB entries)
  8. 2282775Domain d5t5fl1: 5t5f L:1-112 [326076]
    Other proteins in same PDB: d5t5fl2
    automated match to d1kegl1

Details for d5t5fl1

PDB Entry: 5t5f (more details), 2.98 Å

PDB Description: neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
PDB Compounds: (L:) Monoclonal antibody Jar5 light chain

SCOPe Domain Sequences for d5t5fl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t5fl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaapsvpvtpgesvsiscrssksllhsngntylfwflqrpgqspqlliyrmsnla
sgvpdrfsgsgsgtsftlrisrveaedvgvyycmqhleypytfgggtkleik

SCOPe Domain Coordinates for d5t5fl1:

Click to download the PDB-style file with coordinates for d5t5fl1.
(The format of our PDB-style files is described here.)

Timeline for d5t5fl1:

  • d5t5fl1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13