SCOPe 2.08: Domain d5t5fl1: 5t5f L:1-112

Lineage for d5t5fl1 (5t5f L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5t5fl1: 5t5f L:1-112 [326076]
   Other proteins in same PDB: d5t5fh_, d5t5fl2
   automated match to d1kegl1

Details for d5t5fl1

PDB Entry: 5t5f, 2.98 Å

PDB Description: neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5

PDB Compounds: (L:) Monoclonal antibody Jar5 light chain

SCOPe Domain Sequences for d5t5fl1:

Sequence; same for both SEQRES and ATOM records:

>d5t5fl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaapsvpvtpgesvsiscrssksllhsngntylfwflqrpgqspqlliyrmsnla
sgvpdrfsgsgsgtsftlrisrveaedvgvyycmqhleypytfgggtkleik

Timeline for d5t5fl1:

• d5t5fl1 first appeared in SCOPe 2.06
  
• d5t5fl1 appears in SCOPe 2.07