SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t5fl1 (5t5f L:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2282775Domain d5t5fl1: 5t5f L:1-112 [326076]
    Other proteins in same PDB: d5t5fl2
    automated match to d1kegl1

Details for d5t5fl1

PDB Entry: 5t5f (more details), 2.98 Å

PDB Description: neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
PDB Compounds: (L:) Monoclonal antibody Jar5 light chain

SCOPe Domain Sequences for d5t5fl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t5fl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaapsvpvtpgesvsiscrssksllhsngntylfwflqrpgqspqlliyrmsnla
sgvpdrfsgsgsgtsftlrisrveaedvgvyycmqhleypytfgggtkleik

SCOPe Domain Coordinates for d5t5fl1:

Click to download the PDB-style file with coordinates for d5t5fl1.
(The format of our PDB-style files is described here.)

Timeline for d5t5fl1:

  • d5t5fl1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13