SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t5fl2 (5t5f L:113-216)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (462 PDB entries)
  8. 2282776Domain d5t5fl2: 5t5f L:113-216 [326077]
    Other proteins in same PDB: d5t5fl1
    automated match to d1p7kl2

Details for d5t5fl2

PDB Entry: 5t5f (more details), 2.98 Å

PDB Description: neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
PDB Compounds: (L:) Monoclonal antibody Jar5 light chain

SCOPe Domain Sequences for d5t5fl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t5fl2 b.1.1.2 (L:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d5t5fl2:

Click to download the PDB-style file with coordinates for d5t5fl2.
(The format of our PDB-style files is described here.)

Timeline for d5t5fl2:

  • d5t5fl2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13