SCOPe 2.08: Domain d5l62c1: 5l62 C:1-234

Lineage for d5l62c1 (5l62 C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d5l62c1: 5l62 C:1-234 [325953]
   Other proteins in same PDB: d5l62a_, d5l62b_, d5l62c2, d5l62f_, d5l62g_, d5l62h_, d5l62i_, d5l62j_, d5l62k_, d5l62l_, d5l62m_, d5l62n_, d5l62o_, d5l62p_, d5l62q2, d5l62t_, d5l62u_, d5l62v_, d5l62w_, d5l62x_, d5l62y_, d5l62z_
   automated match to d1iruf_
   complexed with 79p, cl, mes, mg

Details for d5l62c1

PDB Entry: 5l62, 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l62c1:

Sequence; same for both SEQRES and ATOM records:

>d5l62c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5l62c1:

• d5l62c1 first appeared in SCOPe 2.06, called d5l62c_
  
• d5l62c1 was called d5l62c_ in SCOPe 2.07