Lineage for d5l62b_ (5l62 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2282607Domain d5l62b_: 5l62 B: [325908]
    Other proteins in same PDB: d5l62a_, d5l62c_, d5l62d_, d5l62e_, d5l62g_, d5l62i_, d5l62j_, d5l62k_, d5l62l_, d5l62n_, d5l62o_, d5l62q_, d5l62r_, d5l62s_, d5l62u_, d5l62w_, d5l62x_, d5l62y_, d5l62z_
    automated match to d1z7qc1
    complexed with 79p, cl, mes, mg

Details for d5l62b_

PDB Entry: 5l62 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l62b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l62b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l62b_:

Click to download the PDB-style file with coordinates for d5l62b_.
(The format of our PDB-style files is described here.)

Timeline for d5l62b_:

  • d5l62b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13