Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l62e_: 5l62 E: [325892] Other proteins in same PDB: d5l62a_, d5l62b_, d5l62c2, d5l62f_, d5l62g_, d5l62h_, d5l62i_, d5l62j_, d5l62k_, d5l62l_, d5l62m_, d5l62n_, d5l62o_, d5l62p_, d5l62q2, d5l62t_, d5l62u_, d5l62v_, d5l62w_, d5l62x_, d5l62y_, d5l62z_ automated match to d4g4se_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l62 (more details), 2.8 Å
SCOPe Domain Sequences for d5l62e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l62e_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l62e_:
View in 3D Domains from other chains: (mouse over for more information) d5l62a_, d5l62b_, d5l62c1, d5l62c2, d5l62d_, d5l62f_, d5l62g_, d5l62h_, d5l62i_, d5l62j_, d5l62k_, d5l62l_, d5l62m_, d5l62n_, d5l62o_, d5l62p_, d5l62q1, d5l62q2, d5l62r_, d5l62s_, d5l62t_, d5l62u_, d5l62v_, d5l62w_, d5l62x_, d5l62y_, d5l62z_ |