Lineage for d5l54d_ (5l54 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990638Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2990693Domain d5l54d_: 5l54 D: [325486]
    Other proteins in same PDB: d5l54a_, d5l54c2, d5l54h_, d5l54i_, d5l54j_, d5l54k_, d5l54l_, d5l54m_, d5l54n_, d5l54o_, d5l54q2, d5l54v_, d5l54w_, d5l54x_, d5l54y_, d5l54z_
    automated match to d1iruf_
    complexed with 79p, cl, mes, mg

Details for d5l54d_

PDB Entry: 5l54 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 16
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l54d_:

Sequence, based on SEQRES records: (download)

>d5l54d_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l54d_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l54d_:

Click to download the PDB-style file with coordinates for d5l54d_.
(The format of our PDB-style files is described here.)

Timeline for d5l54d_: