SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l54t_ (5l54 T:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2202407Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2282339Domain d5l54t_: 5l54 T: [325640]
    Other proteins in same PDB: d5l54a_, d5l54e_, d5l54h_, d5l54i_, d5l54j_, d5l54k_, d5l54l_, d5l54m_, d5l54n_, d5l54o_, d5l54s_, d5l54v_, d5l54w_, d5l54x_, d5l54y_, d5l54z_
    automated match to d4g4sg_
    complexed with 79p, cl, mes, mg

Details for d5l54t_

PDB Entry: 5l54 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 16
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l54t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l54t_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l54t_:

Click to download the PDB-style file with coordinates for d5l54t_.
(The format of our PDB-style files is described here.)

Timeline for d5l54t_:

  • d5l54t_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12