Lineage for d5l54p_ (5l54 P:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2201437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2282411Domain d5l54p_: 5l54 P: [325712]
    Other proteins in same PDB: d5l54a_, d5l54e_, d5l54h_, d5l54i_, d5l54j_, d5l54k_, d5l54l_, d5l54m_, d5l54n_, d5l54o_, d5l54s_, d5l54v_, d5l54w_, d5l54x_, d5l54y_, d5l54z_
    automated match to d1z7qc1
    complexed with 79p, cl, mes, mg

Details for d5l54p_

PDB Entry: 5l54 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 16
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l54p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l54p_ d.153.1.4 (P:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l54p_:

Click to download the PDB-style file with coordinates for d5l54p_.
(The format of our PDB-style files is described here.)

Timeline for d5l54p_:

  • d5l54p_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12