Lineage for d1eloa2 (1elo A:5-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867119Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 2867120Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 2867126Domain d1eloa2: 1elo A:5-282 [32145]
    Other proteins in same PDB: d1eloa1, d1eloa3, d1eloa4
    has additional subdomain(s) that are not in the common domain

Details for d1eloa2

PDB Entry: 1elo (more details), 2.8 Å

PDB Description: elongation factor g without nucleotide
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1eloa2:

Sequence, based on SEQRES records: (download)

>d1eloa2 c.37.1.8 (A:5-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
veydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergit
itaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrq
aekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmk
aytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelva
airkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d1eloa2 c.37.1.8 (A:5-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
ldavvdylps

SCOPe Domain Coordinates for d1eloa2:

Click to download the PDB-style file with coordinates for d1eloa2.
(The format of our PDB-style files is described here.)

Timeline for d1eloa2: