Lineage for d1eloa1 (1elo A:283-399)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793028Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 2793029Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)
  8. 2793035Domain d1eloa1: 1elo A:283-399 [25710]
    Other proteins in same PDB: d1eloa2, d1eloa3, d1eloa4

Details for d1eloa1

PDB Entry: 1elo (more details), 2.8 Å

PDB Description: elongation factor g without nucleotide
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1eloa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eloa1 b.43.3.1 (A:283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil

SCOPe Domain Coordinates for d1eloa1:

Click to download the PDB-style file with coordinates for d1eloa1.
(The format of our PDB-style files is described here.)

Timeline for d1eloa1: