Lineage for d5fuyf2 (5fuy F:339-384)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640848Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2640849Protein automated matches [190463] (9 species)
    not a true protein
  7. 2640929Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries)
  8. 2640941Domain d5fuyf2: 5fuy F:339-384 [320143]
    Other proteins in same PDB: d5fuya1, d5fuyb1, d5fuyc1, d5fuyd1, d5fuye1, d5fuye3, d5fuyf1
    automated match to d1xbta2
    complexed with po4, qbt, zn

Details for d5fuyf2

PDB Entry: 5fuy (more details), 2.8 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
PDB Compounds: (F:) thymdine kinase

SCOPe Domain Sequences for d5fuyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fuyf2 g.39.1.0 (F:339-384) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkrnm

SCOPe Domain Coordinates for d5fuyf2:

Click to download the PDB-style file with coordinates for d5fuyf2.
(The format of our PDB-style files is described here.)

Timeline for d5fuyf2: