Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
Protein automated matches [190463] (9 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries) |
Domain d5fuye2: 5fuy E:339-384 [320040] Other proteins in same PDB: d5fuya1, d5fuyb1, d5fuyc1, d5fuyd1, d5fuye1, d5fuye3, d5fuyf1 automated match to d1xbta2 complexed with po4, qbt, zn |
PDB Entry: 5fuy (more details), 2.8 Å
SCOPe Domain Sequences for d5fuye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fuye2 g.39.1.0 (E:339-384) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkrnm
Timeline for d5fuye2: