Lineage for d5fuyd2 (5fuy D:339-382)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
alpha+beta metal(zinc)-bound foldSuperfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) 
Family g.39.1.0: automated matches [191378] (1 protein)
not a true familyProtein automated matches [190463] (9 species)
not a true protein
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries) 
Domain d5fuyd2: 5fuy D:339-382 [319949]
Other proteins in same PDB: d5fuya1, d5fuyb1, d5fuyc1, d5fuyd1, d5fuye1, d5fuye3, d5fuyf1
automated match to d1xbta2
complexed with po4, qbt, zn
Details for d5fuyd2
PDB Entry: 5fuy (more details), 2.8 Å
PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
PDB Compounds: (D:) thymdine kinaseSCOPe Domain Sequences for d5fuyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fuyd2 g.39.1.0 (D:339-382) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkr
SCOPe Domain Coordinates for d5fuyd2:
Click to download the PDB-style file with coordinates for d5fuyd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5fuyd2:
View in 3D
