Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319946] (4 PDB entries) |
Domain d5fuye1: 5fuy E:204-338 [320039] Other proteins in same PDB: d5fuya2, d5fuyb2, d5fuyc2, d5fuyd2, d5fuye2, d5fuye3, d5fuyf2 automated match to d1xbta1 complexed with po4, qbt, zn |
PDB Entry: 5fuy (more details), 2.8 Å
SCOPe Domain Sequences for d5fuye1:
Sequence, based on SEQRES records: (download)
>d5fuye1 c.37.1.0 (E:204-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} hgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtrysegaitshdqraltan vsvsnlhdvgdewrkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfee icllvsradsvvkls
>d5fuye1 c.37.1.0 (E:204-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} hgrieliigpmfagkttelmrrvqrhkhaqrscyiikytraltanvsvsnlhdvgdewrk ydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfeeicllvsradsvvkls
Timeline for d5fuye1: