Lineage for d5iy0c1 (5iy0 C:2-252)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790635Species Pyrococcus furiosus [TaxId:186497] [238494] (2 PDB entries)
  8. 2790644Domain d5iy0c1: 5iy0 C:2-252 [319609]
    Other proteins in same PDB: d5iy0a2, d5iy0b2, d5iy0c2, d5iy0d2, d5iy0e2, d5iy0f2
    automated match to d1ltle_
    complexed with zn

Details for d5iy0c1

PDB Entry: 5iy0 (more details), 3 Å

PDB Description: pfmcm n-terminal domain double hexamer
PDB Compounds: (C:) Cell division control protein 21

SCOPe Domain Sequences for d5iy0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy0c1 b.40.4.0 (C:2-252) automated matches {Pyrococcus furiosus [TaxId: 186497]}
dreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahevi
enpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqvegi
vtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssfvn
fqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpifr
kilevnhiepv

SCOPe Domain Coordinates for d5iy0c1:

Click to download the PDB-style file with coordinates for d5iy0c1.
(The format of our PDB-style files is described here.)

Timeline for d5iy0c1: