Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [238494] (2 PDB entries) |
Domain d5iy0c1: 5iy0 C:2-252 [319609] Other proteins in same PDB: d5iy0a2, d5iy0b2, d5iy0c2, d5iy0d2, d5iy0e2, d5iy0f2 automated match to d1ltle_ complexed with zn |
PDB Entry: 5iy0 (more details), 3 Å
SCOPe Domain Sequences for d5iy0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iy0c1 b.40.4.0 (C:2-252) automated matches {Pyrococcus furiosus [TaxId: 186497]} dreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahevi enpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqvegi vtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssfvn fqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpifr kilevnhiepv
Timeline for d5iy0c1: