Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.11: DNA replication initiator (cdc21/cdc54) N-terminal domain [89332] (2 proteins) |
Protein DNA replication initiator (cdc21/cdc54) N-terminal domain [89333] (3 species) MCM complex protein; dodecamer assembly; includes the N-terminal all-alpha subdomain and inserted Zn-finger |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [89334] (1 PDB entry) |
Domain d1ltle_: 1ltl E: [84705] complexed with zn |
PDB Entry: 1ltl (more details), 3 Å
SCOPe Domain Sequences for d1ltle_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltle_ b.40.4.11 (E:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} mktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliek pddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktde irprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklq eplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnyte fl
Timeline for d1ltle_: