Lineage for d2hgsa1 (2hgs A:202-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862078Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein)
    circularly permuted version of prokaryotic enzyme
    automatically mapped to Pfam PF03199
  6. 2862079Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species)
  7. 2862085Species Human (Homo sapiens) [TaxId:9606] [52462] (1 PDB entry)
  8. 2862086Domain d2hgsa1: 2hgs A:202-303 [31722]
    Other proteins in same PDB: d2hgsa4
    complexed with adp, gsh, mg, so4

Details for d2hgsa1

PDB Entry: 2hgs (more details), 2.1 Å

PDB Description: human glutathione synthetase
PDB Compounds: (A:) protein (glutathione synthetase)

SCOPe Domain Sequences for d2hgsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgsa1 c.30.1.4 (A:202-303) Eukaryotic glutathione synthetase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]}
pnalvlliaqekernifdqraienellarnihvirrtfedisekgsldqdrrlfvdgqei
avvyfrdgymprqyslqnwearlllershaakcpdiatqlag

SCOPe Domain Coordinates for d2hgsa1:

Click to download the PDB-style file with coordinates for d2hgsa1.
(The format of our PDB-style files is described here.)

Timeline for d2hgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hgsa4