![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein) circularly permuted version of prokaryotic enzyme automatically mapped to Pfam PF03199 |
![]() | Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52462] (1 PDB entry) |
![]() | Domain d2hgsa1: 2hgs A:202-303 [31722] Other proteins in same PDB: d2hgsa4 complexed with adp, gsh, mg, so4 |
PDB Entry: 2hgs (more details), 2.1 Å
SCOPe Domain Sequences for d2hgsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgsa1 c.30.1.4 (A:202-303) Eukaryotic glutathione synthetase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]} pnalvlliaqekernifdqraienellarnihvirrtfedisekgsldqdrrlfvdgqei avvyfrdgymprqyslqnwearlllershaakcpdiatqlag
Timeline for d2hgsa1: