PDB entry 2hgs

View 2hgs on RCSB PDB site
Description: human glutathione synthetase
Class: amine/carboxylate ligase
Keywords: amine/carboxylate ligase
Deposited on 1999-01-04, released 1999-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutathione synthetase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hgsa1, d2hgsa4
  • Heterogens: MG, SO4, ADP, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hgsA (A:)
    matnwgsllqdkqqleelarqavdralaegvllrtsqeptssevvsyapftlfpslvpsa
    lleqayavqmdfnllvdavsqnaafleqtlsstikqddftarlfdihkqvlkegiaqtvf
    lglnrsdymfqrsadgspalkqieintisasfgglasrtpavhrhvlsvlsktkeagkil
    snnpskglalgiakawelygspnalvlliaqekernifdqraienellarnihvirrtfe
    disekgsldqdrrlfvdgqeiavvyfrdgymprqyslqnwearlllershaakcpdiatq
    lagtkkvqqelsrpgmlemllpgqpeavarlratfaglysldvgeegdqaiaealaapsr
    fvlkpqregggnnlygeemvqalkqlkdseerasyilmekiepepfencllrpgsparvv
    qciselgifgvyvrqektlvmnkhvghllrtkaiehadggvaagvavldnpypv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgsA (A:)
    tnwgsllqdkqqleelarqavdralaegvllrtsqeptssevvsyapftlfpslvpsall
    eqayavqmdfnllvdavsqnaafleqtlsstikqddftarlfdihkqvlkegiaqtvflg
    lnrsdymfqrsadgspalkqieintisasfgglasrtpavhrhvlsvlsktkeagkilsn
    npskglalgiakawelygspnalvlliaqekernifdqraienellarnihvirrtfedi
    sekgsldqdrrlfvdgqeiavvyfrdgymprqyslqnwearlllershaakcpdiatqla
    gtkkvqqelsrpgmlemllpgqpeavarlratfaglysldvgeegdqaiaealaapsrfv
    lkpqregggnnlygeemvqalkqlkdseerasyilmekiepepfencllrpgsparvvqc
    iselgifgvyvrqektlvmnkhvghllrtkaiehadggvaagvavldnpypv