![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
![]() | Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) ![]() |
![]() | Family c.30.1.4: Eukaryotic glutathione synthetase [52460] (1 protein) |
![]() | Protein Eukaryotic glutathione synthetase [52461] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52462] (1 PDB entry) |
![]() | Domain d2hgsa1: 2hgs A:202-303 [31722] Other proteins in same PDB: d2hgsa2, d2hgsa3 |
PDB Entry: 2hgs (more details), 2.1 Å
SCOP Domain Sequences for d2hgsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgsa1 c.30.1.4 (A:202-303) Eukaryotic glutathione synthetase {Human (Homo sapiens)} pnalvlliaqekernifdqraienellarnihvirrtfedisekgsldqdrrlfvdgqei avvyfrdgymprqyslqnwearlllershaakcpdiatqlag
Timeline for d2hgsa1: