Lineage for d2hgsa4 (2hgs A:3-201,A:304-474)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.6: Eukaryotic glutathione synthetase ATP-binding domain [56088] (1 protein)
    circularly permuted version of prokaryotic enzyme
    automatically mapped to Pfam PF03917
  6. Protein Eukaryotic glutathione synthetase ATP-binding domain [56089] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56090] (1 PDB entry)
  8. Domain d2hgsa4: 2hgs A:3-201,A:304-474 [75997]
    Other proteins in same PDB: d2hgsa1
    complexed with adp, gsh, mg, so4

Details for d2hgsa4

PDB Entry: 2hgs (more details), 2.1 Å

PDB Description: human glutathione synthetase
PDB Compounds: (A:) protein (glutathione synthetase)

SCOPe Domain Sequences for d2hgsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tnwgsllqdkqqleelarqavdralaegvllrtsqeptssevvsyapftlfpslvpsall
eqayavqmdfnllvdavsqnaafleqtlsstikqddftarlfdihkqvlkegiaqtvflg
lnrsdymfqrsadgspalkqieintisasfgglasrtpavhrhvlsvlsktkeagkilsn
npskglalgiakawelygsXtkkvqqelsrpgmlemllpgqpeavarlratfaglysldv
geegdqaiaealaapsrfvlkpqregggnnlygeemvqalkqlkdseerasyilmekiep
epfencllrpgsparvvqciselgifgvyvrqektlvmnkhvghllrtkaiehadggvaa
gvavldnpypv

SCOPe Domain Coordinates for d2hgsa4 are not available.

Timeline for d2hgsa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hgsa1