SCOPe 2.05: Domain d4zdwc_: 4zdw C:

Lineage for d4zdwc_ (4zdw C:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family)
   dimeric coiled coil

5. Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)

6. Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species)

7. Species Saccharomyces cerevisiae [TaxId:559292] [278245] (1 PDB entry)

8. Domain d4zdwc_: 4zdw C: [278247]
   Other proteins in same PDB: d4zdwa_
   automated match to d2eqbc_
   complexed with gdp; mutant

Details for d4zdwc_

PDB Entry: 4zdw, 2.9 Å

PDB Description: crystal structure of the rab gtpase sec4p mutant - s29v in complex with sec2p and gdp

PDB Compounds: (C:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d4zdwc_:

Sequence; same for both SEQRES and ATOM records:

>d4zdwc_ h.1.33.1 (C:) Rab guanine nucleotide exchange factor Sec2 {Saccharomyces cerevisiae [TaxId: 559292]}
snynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslf
deannmvadarkekyaieilnkrlteqlrek

Timeline for d4zdwc_:

• d4zdwc_ is new in SCOPe 2.05-stable
  
• d4zdwc_ is called d4zdwc1 in SCOPe 2.06
  
• d4zdwc_ appears in the current release, SCOPe 2.08, called d4zdwc1