Lineage for d4zdwb_ (4zdw B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969505Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 1969506Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)
  6. 1969507Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species)
  7. 1969514Species Saccharomyces cerevisiae [TaxId:559292] [278245] (1 PDB entry)
  8. 1969515Domain d4zdwb_: 4zdw B: [278246]
    Other proteins in same PDB: d4zdwa_
    automated match to d2eqbc_
    complexed with gdp; mutant

Details for d4zdwb_

PDB Entry: 4zdw (more details), 2.9 Å

PDB Description: crystal structure of the rab gtpase sec4p mutant - s29v in complex with sec2p and gdp
PDB Compounds: (B:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d4zdwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zdwb_ h.1.33.1 (B:) Rab guanine nucleotide exchange factor Sec2 {Saccharomyces cerevisiae [TaxId: 559292]}
snynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslf
deannmvadarkekyaieilnkrlteqlrek

SCOPe Domain Coordinates for d4zdwb_:

Click to download the PDB-style file with coordinates for d4zdwb_.
(The format of our PDB-style files is described here.)

Timeline for d4zdwb_:

  • d4zdwb_ appears in periodic updates to SCOPe 2.05 starting on 2015-10-15
  • d4zdwb_ is called d4zdwb1 in SCOPe 2.06
  • d4zdwb_ appears in the current release, SCOPe 2.07, called d4zdwb1