Lineage for d4zdwa_ (4zdw A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1846974Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189771] (4 PDB entries)
  8. 1846980Domain d4zdwa_: 4zdw A: [278253]
    Other proteins in same PDB: d4zdwb_, d4zdwc_
    automated match to d2eqba_
    complexed with gdp; mutant

Details for d4zdwa_

PDB Entry: 4zdw (more details), 2.9 Å

PDB Description: crystal structure of the rab gtpase sec4p mutant - s29v in complex with sec2p and gdp
PDB Compounds: (A:) Ras-related protein SEC4

SCOPe Domain Sequences for d4zdwa_:

Sequence, based on SEQRES records: (download)

>d4zdwa_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
simkilligdvgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtag
qerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn

Sequence, based on observed residues (ATOM records): (download)

>d4zdwa_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
simkilligdvgvgkscllvrfvedkfnpsfittigidfkiktvdinvklqlwdtagqer
frtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdmetrv
vtadqgealakelgipfiessaknddnvneifftlakliqekidsn

SCOPe Domain Coordinates for d4zdwa_:

Click to download the PDB-style file with coordinates for d4zdwa_.
(The format of our PDB-style files is described here.)

Timeline for d4zdwa_: